HPA036473

AASDH antibody from Atlas Antibodies
ACSF4, LYS2, NRPS998

Antibody data

Product number
HPA036473
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036473, RRID:AB_10673656
Product name
Anti-AASDH
Provider product page
Atlas Antibodies - HPA036473
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RKLSDINQEEASGTSLHQKAIMTFTCHNEINAFVV
LSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTN
IQNLKGLNSPVLIGKSKDPSCV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.