H00132949-B01P

AASDH antibody from Abnova Corporation
ACSF4, LYS2, NRPS998

Antibody data

Product number
H00132949-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00132949-B01P, RRID:AB_1572698
Product name
AASDH purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00132949-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human AASDH protein.
Antigen sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTY
KTVVNAASELSNFLLLHCDFQGIREIGLYCQPGID
LPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCN
LKYILVEKKQINVSLDVSIVFCLYYIYFN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -