HPA016004

CHST8 antibody from Sigma-Aldrich
GALNAC-4-ST1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016004
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016004, RRID:AB_1846731
Product name
Anti-CHST8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016004
Antibody type
Polyclonal
Antigen
Carbohydrate sulfotransferase 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERV
TRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQR
RRRLLIKKMPAAATIPANSSDAPFIRPGPGTLDGR
WVSLHRSQQE
Storage
-20C
Provider Type Product Number
- No reagents -