Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016004 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA016004, RRID:AB_1846731
- Product name
- Anti-CHST8
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERV
TRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQR
RRRLLIKKMPAAATIPANSSDAPFIRPGPGTLDGR
WVSLHRSQQE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Profiling post-centrifugation delay of serum and plasma with antibody bead arrays
Whole-exome sequencing in a single proband reveals a mutation in the CHST8 gene in autosomal recessive peeling skin syndrome.
Qundos U, Hong M, Tybring G, Divers M, Odeberg J, Uhlen M, Nilsson P, Schwenk J
Journal of Proteomics 2013 December;95
Journal of Proteomics 2013 December;95
Whole-exome sequencing in a single proband reveals a mutation in the CHST8 gene in autosomal recessive peeling skin syndrome.
Cabral RM, Kurban M, Wajid M, Shimomura Y, Petukhova L, Christiano AM
Genomics 2012 Apr;99(4):202-8
Genomics 2012 Apr;99(4):202-8
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows membranous and cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pituitary gland shows strong cytoplasmic positivity in endocrine cells.
- Sample type
- HUMAN