Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002678-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002678-M01, RRID:AB_509140
- Product name
- GGT1 monoclonal antibody (M01), clone 1F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GGT1.
- Antigen sequence
TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGI
LFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPL
SSMCPTIMVGQDGQVRMVVG- Isotype
- IgG
- Antibody clone number
- 1F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A quantitative proteomic analysis uncovers the relevance of CUL3 in bladder cancer aggressiveness.
Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.
Analysis of site-specific glycosylation of renal and hepatic γ-glutamyl transpeptidase from normal human tissue.
Grau L, Luque-Garcia JL, González-Peramato P, Theodorescu D, Palou J, Fernandez-Gomez JM, Sánchez-Carbayo M
PloS one 2013;8(1):e53328
PloS one 2013;8(1):e53328
Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.
West MB, Wickham S, Quinalty LM, Pavlovicz RE, Li C, Hanigan MH
The Journal of biological chemistry 2011 Aug 19;286(33):28876-88
The Journal of biological chemistry 2011 Aug 19;286(33):28876-88
Analysis of site-specific glycosylation of renal and hepatic γ-glutamyl transpeptidase from normal human tissue.
West MB, Segu ZM, Feasley CL, Kang P, Klouckova I, Li C, Novotny MV, West CM, Mechref Y, Hanigan MH
The Journal of biological chemistry 2010 Sep 17;285(38):29511-24
The Journal of biological chemistry 2010 Sep 17;285(38):29511-24
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GGT1 monoclonal antibody (M01), clone 1F9 Western Blot analysis of GGT1 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GGT1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of GGT1 transfected lysate using anti-GGT1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GGT1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol