HPA012750

HLA-DMA antibody from Sigma-Aldrich
D6S222E, RING6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012750
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012750, RRID:AB_1853926
Product name
Anti-HLA-DMA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012750
Antibody type
Polyclonal
Antigen
HLA class II histocompatibility antigen, DM alpha chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDE
DQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILF
DKEFCEWMIQQIGPKLDGKIPVSRGFPIAEV
Storage
-20C
Provider Type Product Number
- No reagents -