Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000828-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000828-M01, RRID:AB_509210
- Product name
- CAPS monoclonal antibody (M01), clone 4C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAPS.
- Antigen sequence
MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDR
DGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKL
DRSG- Isotype
- IgG
- Antibody clone number
- 4C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of novel biomarkers in pediatric primitive neuroectodermal tumors and ependymomas by proteome-wide analysis.
de Bont JM, den Boer ML, Kros JM, Passier MM, Reddingius RE, Smitt PA, Luider TM, Pieters R
Journal of neuropathology and experimental neurology 2007 Jun;66(6):505-16
Journal of neuropathology and experimental neurology 2007 Jun;66(6):505-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CAPS expression in transfected 293T cell line by CAPS monoclonal antibody (M01), clone 4C6.Lane 1: CAPS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CAPS is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol