Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000828-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000828-B01P, RRID:AB_1572077
- Product name
- CAPS purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human CAPS protein.
- Antigen sequence
MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDR
DGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKL
DRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV
LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNT
DEEFVAMMTSAWQL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Calcium signaling-related proteins are associated with broncho-pulmonary dysplasia progression.
Magagnotti C, Matassa PG, Bachi A, Vendettuoli V, Fermo I, Colnaghi MR, Carletti RM, Mercadante D, Fattore E, Mosca F, Andolfo A
Journal of proteomics 2013 Dec 6;94:401-12
Journal of proteomics 2013 Dec 6;94:401-12
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CAPS expression in transfected 293T cell line (H00000828-T01) by CAPS MaxPab polyclonal antibody.Lane 1: CAPS transfected lysate(20.79 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CAPS MaxPab polyclonal antibody. Western Blot analysis of CAPS expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of purified MaxPab antibody to CAPS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol