WH0000828M1

CAPS antibody from MilliporeSigma / Merck KGaA
CAPS1, MGC126562
ELISA
Recommended by provider

Antibody data

Product number
WH0000828M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-CAPS antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0000828M1
Antibody type
Monoclonal
Antigen
CAPS (NP_004049, a.a. 1-110) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDR
DGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKL
DRSG* (without GST)
Isotype
IgG
Storage
-20C