Antibody data

Product number
H00010606-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010606-M01, RRID:AB_606711
Product name
PAICS monoclonal antibody (M01), clone 4F4
Provider product page
Abnova Corporation - H00010606-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant PAICS.
Antigen sequence
MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQS
KDQITAGNAARKNHLEGKAAISNKITSCIFQLLQE
AGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIAT
GSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQW
SEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEI
LEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVID
NDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMV
KKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGH
CEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAE
YEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISC
PPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQ
FAAQIFGLSNHLVWSKLRASILNTWISLKQADKKI
RECNL
Isotype
IgG
Antibody clone number
4F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -