HPA009298

KLHL31 antibody from Sigma-Aldrich
bA345L23.2, BKLHD6, KBTBD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009298
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009298, RRID:AB_1852190
Product name
Anti-KLHL31 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009298
Antibody type
Polyclonal
Antigen
Kelch-like protein 31 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLS
CISSELTDASYGPNLLEGLSKMRQENFLCDLVIGT
KTKSFDVHKSVMASCSEYFYNILKKDPSIQRVDLN
DISPLGLATVIAYAYTGK
Storage
-20C
Provider Type Product Number
- No reagents -