HPA030180

antibody from Atlas Antibodies

Targeting: HOPX HOP, LAGY, NECC1, OB1, SMAP31

Antibody data

Submit

Validation data

Product number: HPA030180 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA030180, RRID:AB_10603770
Product name: Anti-HOPX
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEIL EYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFK QRLAKWRRSEGLPSECRSVTD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HOPX protein structure - HPA030180 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skin and liver tissues using HPA030180 antibody. Corresponding HOPX RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows moderate cytoplasmic and nuclear positivity in epidermal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows moderate positivity in stratum granulosum.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows moderate positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN