Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084525-B02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084525-B02, RRID:AB_1115539
- Product name
- HOP MaxPab mouse polyclonal antibody (B02)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human HOP protein.
- Antigen sequence
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCL
IAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS
VID- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HOPX expression in transfected 293T cell line (H00084525-T02) by HOPX MaxPab polyclonal antibody.Lane 1: HOP transfected lysate(8.03 KDa).Lane 2: Non-transfected lysate.