HPA011276

SSR1 antibody from Atlas Antibodies
TRAPA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011276
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011276, RRID:AB_1857503
Product name
Anti-SSR1
Provider product page
Atlas Antibodies - HPA011276
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQI
NKASPRRLPRKRAQKRSVGSDE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -