HPA017062

antibody from Atlas Antibodies

Targeting: SSR1 TRAPA

Antibody data

Submit

Validation data

Product number: HPA017062 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA017062, RRID:AB_1857505
Product name: Anti-SSR1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VSGEPEASPSADTTILFVKGEDFPANNIVKFLVGF TNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPL NTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNY KDLNGNVFQDAVFNQTVT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SSR1 protein structure - HPA017062 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, lymph node and pancreas using Anti-SSR1 antibody HPA017062 (A) shows similar protein distribution across tissues to independent antibody HPA011276 (B).
Antibody #2 product nr: HPA011276
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong positivity in exocrine cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SSR1 antibody HPA017062.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-SSR1 antibody HPA017062.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-SSR1 antibody HPA017062.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SSR1 antibody HPA017062.
Sample type: HUMAN