HPA008999
antibody from Atlas Antibodies
Targeting: EFNB2
EPLG5, Htk-L, HTKL, LERK5, MGC126226, MGC126227, MGC126228
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008999 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008999, RRID:AB_1078721
- Product name
- Anti-EFNB2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEP
SDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEM
P- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Spatial regulation of VEGF receptor endocytosis in angiogenesis.
Ephrin-B2 controls PDGFRβ internalization and signaling.
Nakayama M, Nakayama A, van Lessen M, Yamamoto H, Hoffmann S, Drexler HC, Itoh N, Hirose T, Breier G, Vestweber D, Cooper JA, Ohno S, Kaibuchi K, Adams RH
Nature cell biology 2013 Mar;15(3):249-60
Nature cell biology 2013 Mar;15(3):249-60
Ephrin-B2 controls PDGFRβ internalization and signaling.
Nakayama A, Nakayama M, Turner CJ, Höing S, Lepore JJ, Adams RH
Genes & development 2013 Dec 1;27(23):2576-89
Genes & development 2013 Dec 1;27(23):2576-89
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and cells in glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate membranous positivity in endothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows weak to moderate membranous positivity in pneumocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows weak to moderate membranous positivity in glandular cells.
- Sample type
- HUMAN