HPA008999

EFNB2 antibody from Sigma-Aldrich
EPLG5, Htk-L, HTKL, LERK5, MGC126226, MGC126227, MGC126228
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008999
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008999, RRID:AB_1078721
Product name
Anti-EFNB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008999
Antibody type
Polyclonal
Antigen
Ephrin-B2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEP
SDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEM
P
Storage
-20C
Provider Type Product Number
- No reagents -