HPA012757

EML2 antibody from Sigma-Aldrich
ELP70, EMAP-2, EMAP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012757
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012757, RRID:AB_1848145
Product name
Anti-EML2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012757
Antibody type
Polyclonal
Antigen
Echinoderm microtubule-associated protein-like 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYV
GTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPS
RAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARS
AGFHPSGSVLAVG
Storage
-20C
Provider Type Product Number
- No reagents -