Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405761 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Glycogen Synthase 2, Liver (GYS2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GYS2 antibody: synthetic peptide directed towards the middle region of human GYS2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSP
SGSQA SSPQSSDVED- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
Watanabe I, Tomita A, Shimizu M, Sugawara M, Yasumo H, Koishi R, Takahashi T, Miyoshi K, Nakamura K, Izumi T, Matsushita Y, Furukawa H, Haruyama H, Koga T
Clinical pharmacology and therapeutics 2003 May;73(5):435-55
Clinical pharmacology and therapeutics 2003 May;73(5):435-55
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting