Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038281 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA038281, RRID:AB_10672408
- Product name
- Anti-UCN3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRS
FHYLRSRDASSGEEEEGKEK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Aging Impairs Adaptive Unfolded Protein Response and Drives Beta Cell Dedifferentiation in Humans
iPSC-derived β cells model diabetes due to glucokinase deficiency
Song J, Ni Q, Sun J, Xie J, Liu J, Ning G, Wang W, Wang Q
The Journal of Clinical Endocrinology & Metabolism 2022;107(12):3231-3241
The Journal of Clinical Endocrinology & Metabolism 2022;107(12):3231-3241
iPSC-derived β cells model diabetes due to glucokinase deficiency
Hua H, Shang L, Martinez H, Freeby M, Gallagher M, Ludwig T, Deng L, Greenberg E, LeDuc C, Chung W, Goland R, Leibel R, Egli D
Journal of Clinical Investigation 2013;123(7):3146-3153
Journal of Clinical Investigation 2013;123(7):3146-3153
No comments: Submit comment
No validations: Submit validation data