HPA009300

CD93 antibody from Sigma-Aldrich
C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009300
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009300, RRID:AB_1846342
Product name
Anti-CD93 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009300
Antibody type
Polyclonal
Antigen
Complement component C1q receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPS
GPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKAT
PTTSRPSLSSDAPITSAPLKMLAPSGSSGVWREPS
IHHATAASGPQEPAGGDSSVATQNNDGTDGQKL
Storage
-20C
Provider Type Product Number
- No reagents -