HPA012368

CD93 antibody from Atlas Antibodies
C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012368
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012368, RRID:AB_1233794
Product name
Anti-CD93
Provider product page
Atlas Antibodies - HPA012368
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCL
DPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR
CVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNI
EGFVCKFS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -