H00010127-M07

ZNF263 antibody from Abnova Corporation
FPM315, ZKSCAN12, ZSCAN44

Antibody data

Product number
H00010127-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010127-M07, RRID:AB_1237914
Product name
ZNF263 monoclonal antibody (M07), clone 3C9
Provider product page
Abnova Corporation - H00010127-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ZNF263.
Antigen sequence
MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGP
SPEASHLRFRRFRFQEAAGPREALSRLQELCHGWL
RPEMRTKERILELLVLEQFLTILPQEIQSRVQELH
PESGEEAVTLVEDMQRELGRLRQQVTNHGRGTEVL
LEEPLPLETARESPSFKLEPMETERSPGPRLQELL
GPSPQRDPQAVKERALSAPWLSLFPPEGNMEDKEM
TGPQLPESLEDVAMYISQEEWGHQDPSKRALSRDT
VQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPS
VQSCKEGLSPRGPAPGEEKFENLEGVPSVCSENIH
PQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPE
GGMEQALAGASSGRELGRPKELQPKKLHLCPLCGK
NFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPR
FLSLHRAHLGEGAHKCLECGKCFSQNTHLTRHQRT
HTGEKPYQCNICGKCFSCNSNLHRHQRTHTGEKPY
KCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGK
SFSRSSHLVIHERTHERERLYPFSECGEAVSDSTP
FLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQR
THTGEKPYKCTLCGENFSHRSNLIRHQRIHTGEKP
YTCHECGDSFSHSSNRIRHLRTHTGERPYKCSECG
ESFSRSSRLMSHQRTHTG
Isotype
IgG
Antibody clone number
3C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -