Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15696 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15696, RRID:AB_10677247
- Product name
- Rrbp1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Rrbp1.
- Antigen sequence
AVPPAEQDPMKLKTQLERTEATLEDEQTRRQKLTA
EFEEAQRTACRIQEELEELRAASPLGSSAKEEVTQ
LKERLEKEKRLTSDLGRAAIKLQELLKTTQEQLTK
EKDTVKKLQEQLGKAEDGSSSKEGTSV- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references The ribosome receptor, p180, interacts with kinesin heavy chain, KIF5B.
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Diefenbach RJ, Diefenbach E, Douglas MW, Cunningham AL
Biochemical and biophysical research communications 2004 Jul 2;319(3):987-92
Biochemical and biophysical research communications 2004 Jul 2;319(3):987-92
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
No comments: Submit comment
No validations: Submit validation data