HPA011924

RRBP1 antibody from Atlas Antibodies
ES/130, hES
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011924
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011924, RRID:AB_1856476
Product name
Anti-RRBP1
Provider product page
Atlas Antibodies - HPA011924
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLCLIEAQTMEALLALLPELSVLAQQNYTEWLQDL
KEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTL
QAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAK
VGAAEEELQKSRVTVKHLE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -