HPA009431

LRRN4 antibody from Sigma-Aldrich
C20orf75, dJ1056H1.1, NLRR4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009431
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009431, RRID:AB_1078346
Product name
Anti-LRRN4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009431
Antibody type
Polyclonal
Antigen
Leucine-rich repeat neuronal protein 4 Precursor (Neuronal leucine-rich repeat protein 4) (NLRR-4)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVTLEVLDLSGTFLERVESGWIRDLPKLTSLYLRK
MPRLTTLEGDIFKMTPNLQQLDCQDSPALASVATH
IFQDTPHLQVLLFQNCNLSSFPPWTLDSSQVLSIN
LFGNPLTCSCDLSWLLTDAKRTVLSRAAD
Storage
-20C
Provider Type Product Number
- No reagents -