Antibody data

Product number
H00000810-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000810-M04, RRID:AB_1136903
Product name
CALML3 monoclonal antibody (M04), clone 2A11
Provider product page
Abnova Corporation - H00000810-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CALML3.
Antigen sequence
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGT
VMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFL
GMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAE
LRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYE
EFVRVLVSK
Isotype
IgG
Antibody clone number
2A11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -