HPA012369

IGFLR1 antibody from MilliporeSigma / Merck KGaA
FLJ22573, TMEM149, U2AF1L4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012369
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA012369, RRID:AB_1858095
Product name
Anti-TMEM149 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA012369
Antibody type
Polyclonal
Antigen
Transmembrane protein 149 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGM
AHGTTRHLAARYGLPAAWSTFAYSLRPSRSPLRAL
IEMVVAREPSASLGQLGTHLAQLGRADALRVLSKL
GSSGVCW
Storage
-20C
Provider Type Product Number
- No reagents -