Antibody data

Product number
ABIN785534
Provider
antibodies-online
Product name
anti-Crystallin, beta B3 (CRYbB3) (Middle Region) antibody
Provider product page
antibodies-online - ABIN785534
Antibody type
Polyclonal
Antigen
The immunogen for anti-CRYBB3 antibody: synthetic peptide directed towards the middle region of human CRYBB3
Description
Affinity Purified
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWA
HGFQD RVASVRAING
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -