Antibody data

Product number
H00001417-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001417-M01, RRID:AB_1237679
Product name
CRYBB3 monoclonal antibody (M01), clone 4H6
Provider product page
Abnova Corporation - H00001417-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CRYBB3.
Antigen sequence
PHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQD
RVASVRAINGTWVGYEFPGYRGRQYVFERGEYRHW
NEWDASQPQLQSVRRIRDQKWHKRGRFPSS
Isotype
IgG
Antibody clone number
4H6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -