HPA004802

LAMP5 antibody from Sigma-Aldrich
BAD-LAMP, C20orf103, dJ1119D9.3, UNC-43
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004802
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004802, RRID:AB_10603682
Product name
Anti-C20orf103 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004802
Antibody type
Polyclonal
Antigen
LAMP family protein C20orf103 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCG
HSQSELQVFWVDRAYALKMLFVKESHNMSKGPEAT
WRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLS
ALVTPAGKSYECQAQQTISLA
Storage
-20C
Provider Type Product Number
- No reagents -