HPA011218

CDHR3 antibody from Atlas Antibodies
CDH28, FLJ23834, FLJ44366
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011218
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011218, RRID:AB_1078886
Product name
Anti-CDHR3
Provider product page
Atlas Antibodies - HPA011218
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWE
EDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFM
NRAYPKPHPGK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -