HPA011218

CDHR3 antibody from Sigma-Aldrich
CDH28, FLJ23834, FLJ44366
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011218
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011218, RRID:AB_1078886
Product name
Anti-AC004836.2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011218
Antibody type
Polyclonal
Antigen
Cadherin-like protein 28 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWE
EDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFM
NRAYPKPHPGK
Storage
-20C
Provider Type Product Number
- No reagents -