PAB22256

CCDC198 antibody from Abnova Corporation
C14orf105, FLJ10650

Antibody data

Product number
PAB22256
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22256, RRID:AB_10963658
Product name
C14orf105 polyclonal antibody
Provider product page
Abnova Corporation - PAB22256
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human C14orf105.
Reactivity
Human
Host
Rabbit
Antigen sequence
LRVIKVAPLQNKEVETPSAGRVDFAFNQNLEEKTS
YSLARLQDQNKALEGQLPPLQENWYGRYSTASRDM
YFDIPLEHRETSIIKRHPPQRLQKLEPIDLPRVIT
SGRLLSQREARTMHKAKQVLEK
Isotype
IgG
Vial size
100 µl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.