HPA010647

CCDC136 antibody from Sigma-Aldrich
DKFZP434G156, KIAA1793, NAG6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010647
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010647, RRID:AB_2259798
Product name
Anti-CCDC136 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010647
Antibody type
Polyclonal
Antigen
Coiled-coiled domain-containing protein 136 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCLEEMQLLQVQSPSIKMSLESYGKSYGSMVPSNE
NCRKTYDTTVDDNESYYKSYTSTQTSSKSFLKSYD
SSTSASEAYGKSYCTTSNSSITYKKSYGSTS
Storage
-20C
Provider Type Product Number
- No reagents -