H00055860-B01P

ACTR10 antibody from Abnova Corporation
ACTR11, Arp10, Arp11, HARP11

Antibody data

Product number
H00055860-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055860-B01P, RRID:AB_1570894
Product name
ACTR10 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055860-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ACTR10 protein.
Antigen sequence
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGP
RCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKE
FIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETL
TRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLD
CGYRESLVLPIYEGIPVLNCWGALPLGGKALHKEL
ETQLLEQCTVDTSVAKEQSLPSVMGSVPEGVLEDI
KARTCFVSDLKRGLKIQAAKFNIDGNNERPSPPPN
VDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSV
ATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGF
LHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKA
NCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIP
DWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -