Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN616987 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATPase, Na+/K+ Transporting, beta 2 Polypeptide (ATP1B2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-Atp1b2 antibody: synthetic peptide corresponding to a region of Mouse
- Description
- Affinity Purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVI
VNISD TESWGQHVQK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cooperative anti-diabetic effects of deoxynojirimycin-polysaccharide by inhibiting glucose absorption and modulating glucose metabolism in streptozotocin-induced diabetic mice.
1-deoxynojirimycin inhibits glucose absorption and accelerates glucose metabolism in streptozotocin-induced diabetic mice.
Li YG, Ji DF, Zhong S, Lv ZQ, Lin TB
PloS one 2013;8(6):e65892
PloS one 2013;8(6):e65892
1-deoxynojirimycin inhibits glucose absorption and accelerates glucose metabolism in streptozotocin-induced diabetic mice.
Li YG, Ji DF, Zhong S, Lin TB, Lv ZQ, Hu GY, Wang X
Scientific reports 2013;3:1377
Scientific reports 2013;3:1377
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting