HPA010698

ATP1B2 antibody from Sigma-Aldrich
AMOG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010698
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010698, RRID:AB_1845174
Product name
Anti-ATP1B2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010698
Antibody type
Polyclonal
Antigen
Sodium/potassium-transporting ATPase subunit beta-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSD
TESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRY
YEQPDNGVLNYPKRACQFNRTQLGNCSGIGDST
Storage
-20C
Provider Type Product Number
- No reagents -