Antibody data

Product number
H00079085-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079085-M04, RRID:AB_1580675
Product name
SLC25A23 monoclonal antibody (M04), clone 3E1
Provider product page
Abnova Corporation - H00079085-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC25A23.
Antigen sequence
RGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQ
GLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEF
SRY
Isotype
IgG
Antibody clone number
3E1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -