H00055145-M01

THAP1 antibody from Abnova Corporation
4833431A01Rik, DYT6, FLJ10477

Antibody data

Product number
H00055145-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055145-M01, RRID:AB_426004
Product name
THAP1 monoclonal antibody (M01), clone 2C1-2F2
Provider product page
Abnova Corporation - H00055145-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant THAP1.
Antigen sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKE
WEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNK
LLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPL
PPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVE
DTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQER
QLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVE
VPA
Isotype
IgG
Antibody clone number
2C1-2F2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -