HPA071310

THAP1 antibody from Atlas Antibodies
4833431A01Rik, DYT6, FLJ10477

Antibody data

Product number
HPA071310
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA071310, RRID:AB_2686386
Product name
Anti-THAP1
Provider product page
Atlas Antibodies - HPA071310
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRK
KLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSER
GYVILPNDYF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -