H00055145-D01

THAP1 antibody from Abnova Corporation
4833431A01Rik, DYT6, FLJ10477

Antibody data

Product number
H00055145-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055145-D01, RRID:AB_10719473
Product name
THAP1 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00055145-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human THAP1 protein.
Antigen sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKE
WEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNK
LLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPL
PPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVE
DTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQER
QLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVE
VPA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -