HPA010682

SIGLEC9 antibody from Sigma-Aldrich
CD329
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010682
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010682, RRID:AB_1079968
Product name
Anti-Siglec-9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010682
Antibody type
Polyclonal
Antigen
Sialic acid-binding Ig-like lectin 9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLV
CAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLE
LPWVHLRDEAEFTCRAQNPLGSQQVYLNVSLQSKA
TSGVTQ
Storage
-20C
Provider Type Product Number
- No reagents -