Antibody data

Product number
H00005256-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005256-M05, RRID:AB_1237814
Product name
PHKA2 monoclonal antibody (M05), clone 1D4
Provider product page
Abnova Corporation - H00005256-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PHKA2.
Antigen sequence
MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSA
SHEQKDAWVRDNIYSILAVWGLGMAYRKNADRDED
KAKAYELEQNVVKLMRGLLQCMMRQVAKVEKFKHT
QSTKDSLHAKYNTATCGTVVGDDQWGHLQVDATSL
FLLFLAQMTASGLRIIFTLDEVAFIQNLVFYIEAA
YKVADYGMWERGDKTNQGIPELNASSVGMAKAALE
AIDELDLFGAHGGRKSVIHVLPDEVEHCQSILFSM
LPRASTSKEIDAGLLSIISFPAFAVEDVNLVNVTK
NEIISKLQGRYGCCRFLRDGYKTPREDPNRLHYDP
AELKLFENIECEWPVFWTYFIIDGVFSGDAVQVQE
YREALEGILIRGKNGIRLVPELYAVPPNKVDEEYK
NPHTVDRVPMGKVPHLWGQSLYILSSLLAEGFLAA
GEIDPLNRRFSTSVKPDVVVQVTVLAENNHIKDLL
RKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNK
NMNLSGRPYRHIGVLGTSKLYVIRNQIFTFTPQFT
DEHHFYLALDNEMIVEMLRIELAYLCTCWRMTGRP
TLTFPISRTMLTNDGSDIHSAVLSTIRKLEDGYFG
GARVKLGNLSEFLTTSFYTYLTFLDPDCDEKLFDN
ASEGTFSPDSDSDLVGYLEDTCNQESQDELDHYIN
HLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDIL
SVMAKAKGLEVPFVPMTLPTKVLSAHRKSLNLVDS
PQPLLEKVPESDFQWPRDDHSDVDCEKLVEQLKDC
SNLQDQADILYILYVIKGPSWDTNLSGQHGVTVQN
LLGELYGKAGLNQEWGLIRYISGLLRKKVEVLAEA
CTDLLSHQKQLTVGLPPEPREKIISAPLPPEELTK
LIYEASGQDISIAVLTQEIVVYLAMYVRAQPSLFV
EMLRLRIGLIIQVMATELARSLNCSGEEASESLMN
LSPFDMKNLLHHILSGKEFGVERSVRPIHSSTSSP
TISIHEVGHTGVTKTERSGINRLRSEMKQMTRRFS
ADEQFFSVGQAASSSAHSSKSARSSTPSSPTGTSS
SDSGGHHIGWGERQGQWLRRRRLDGAINRVPVGFY
QRVWKILQKCHGLSIDGYVLPSSTTREMTPHEIKF
AVHVESVLNRVPQPEYRQLLVEAIMVLTLLSDTEM
TSIGGIIHVDQIVQMASQLFLQDQVSIGAMDTLEK
DQATGICHFFYDSAPSGAYGTMTYLTRAVASYLQE
LLPNSGCQMQ
Isotype
IgG
Antibody clone number
1D4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -