HPA009139

CDH15 antibody from Atlas Antibodies
CDH14, CDH3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009139
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009139, RRID:AB_1078372
Product name
Anti-CDH15
Provider product page
Atlas Antibodies - HPA009139
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGR
IQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTA
TGTLSIEILEVNDHAPVLAPPPPGSLCSEPHQGPG
LLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLS
QVNVSH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -