HPA027032

ASCL3 antibody from Sigma-Aldrich
bHLHa42, HASH3, Sgn1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027032
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027032, RRID:AB_10602434
Product name
Anti-ASCL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027032
Antibody type
Polyclonal
Antigen
achaete-scute complex homolog 3 (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHP
EAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSF
PMPYPNYRGCEYSYGP
Storage
-20C
Provider Type Product Number
- No reagents -