HPA010702

PRRG2 antibody from Sigma-Aldrich
PRGP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010702
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010702, RRID:AB_1079693
Product name
Anti-PRRG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010702
Antibody type
Polyclonal
Antigen
Transmembrane gamma-carboxyglutamic acid protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEVFLGPPEAQSFLSSHTRIPRANHWDLELLTPGN
LERECLEERCSWEEAREYFEDNTLTERFWESYIYN
GKGGRGRVDVA
Storage
-20C
Provider Type Product Number
- No reagents -