Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055288-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055288-M01, RRID:AB_606929
- Product name
- RHOT1 monoclonal antibody (M01), clone 4H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RHOT1.
- Antigen sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMD
SRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMP
PPQAFTCNTADAPSKDIFVKLTTMAMYP- Isotype
- IgG
- Antibody clone number
- 4H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Brain-derived neurotrophic factor (BDNF)-induced mitochondrial motility arrest and presynaptic docking contribute to BDNF-enhanced synaptic transmission.
GTPase of the immune-associated nucleotide-binding protein 5 (GIMAP5) regulates calcium influx in T-lymphocytes by promoting mitochondrial calcium accumulation.
N-acetylglucosamine transferase is an integral component of a kinesin-directed mitochondrial trafficking complex.
GTPase dependent recruitment of Grif-1 by Miro1 regulates mitochondrial trafficking in hippocampal neurons.
Su B, Ji YS, Sun XL, Liu XH, Chen ZY
The Journal of biological chemistry 2014 Jan 17;289(3):1213-26
The Journal of biological chemistry 2014 Jan 17;289(3):1213-26
GTPase of the immune-associated nucleotide-binding protein 5 (GIMAP5) regulates calcium influx in T-lymphocytes by promoting mitochondrial calcium accumulation.
Chen XL, Serrano D, Mayhue M, Wieden HJ, Stankova J, Boulay G, Ilangumaran S, Ramanathan S
The Biochemical journal 2013 Jan 15;449(2):353-64
The Biochemical journal 2013 Jan 15;449(2):353-64
N-acetylglucosamine transferase is an integral component of a kinesin-directed mitochondrial trafficking complex.
Brickley K, Pozo K, Stephenson FA
Biochimica et biophysica acta 2011 Jan;1813(1):269-81
Biochimica et biophysica acta 2011 Jan;1813(1):269-81
GTPase dependent recruitment of Grif-1 by Miro1 regulates mitochondrial trafficking in hippocampal neurons.
MacAskill AF, Brickley K, Stephenson FA, Kittler JT
Molecular and cellular neurosciences 2009 Mar;40(3):301-12
Molecular and cellular neurosciences 2009 Mar;40(3):301-12
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RHOT1 monoclonal antibody (M01), clone 4H4 Western Blot analysis of RHOT1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RHOT1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol