Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310631 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RHOT1 antibody: synthetic peptide directed towards the N terminal of human RHOT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPP
RAEEI TIPADVTPER- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
Brandenberger R, Wei H, Zhang S, Lei S, Murage J, Fisk GJ, Li Y, Xu C, Fang R, Guegler K, Rao MS, Mandalam R, Lebkowski J, Stanton LW
Nature biotechnology 2004 Jun;22(6):707-16
Nature biotechnology 2004 Jun;22(6):707-16
No comments: Submit comment
No validations: Submit validation data