HPA025695

MICALL2 antibody from Atlas Antibodies
FLJ23471, JRAB, MGC46023, MICAL-L2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025695
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025695, RRID:AB_10610140
Product name
Anti-MICALL2
Provider product page
Atlas Antibodies - HPA025695
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPG
RPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQ
LQDIERRLDALELRGVELEKRL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -